Tout
Mots-clés de produits
Veuillez entrer le compte de l'adresse e-mail
KUNIU Love Fashion Zircon Belly Button Ring
Partager à:

KUNIU Love Fashion Zircon Belly Button Ring

- Blanc + Or
238608801

5 2 Avis des Clients | Référer à la description anglaise
3.12
  • LIVRAISON GRATUITE
    COD Ce produit prend en charge le paiement à la livraison. Suggestions: Ne passez pas de commandes avec des produits autres que payable à la livraison, sinon vous ne pourrez pas choisir ce mode.
    Expédier entre: Sep 30 - Oct 02, Délai d'Expédition Estimé: jours ouvrables Dépendant de votre choix en matière de transport, votre commande sera traitée et expediée sous quelques jours depuis nos entrepôts
  • +
  • sans intérêt Vous pouvez profiter d'un maximum de 0 versements échelonnés sans intérêt et ne pouvez pas profiter de cette offre quand vous passez des commandes avec d'autres produits
;   
Infos Taxes Protection des Prix Avis de Non-Responsabilité Garantie de Réparation d'un An Signalez un article
Liquidation

Produits Recommandés Pour Vous

Les Clients Ayant Acheté Cet Article Ont Egalement Acheté

Spécification

Custom

Détails du Produit

Type de Bijoux de Corps: Nombril et de Bell Anneaux de Bouton
Style: Classique
Motif/Forme: Cœur
Poids du produit: 0,0050 kg
Liste d'emballage: 1 x anneau de bouton de ventre

KUNIU Love Fashion Zircon Belly Button Ring- Blanc + Or
KUNIU Love Fashion Zircon Belly Button Ring- Blanc + Or
KUNIU Love Fashion Zircon Belly Button Ring- Blanc + Or
KUNIU Love Fashion Zircon Belly Button Ring- Blanc + Or
KUNIU Love Fashion Zircon Belly Button Ring- Blanc + Or
KUNIU Love Fashion Zircon Belly Button Ring- Blanc + Or
KUNIU Love Fashion Zircon Belly Button Ring- Blanc + Or
KUNIU Love Fashion Zircon Belly Button Ring- Blanc + Or

Suppose que vous aimez

Avis des Clients

5 sur 5
  • 2
  • 0
  • 0
  • 0
  • 0
Voir tous les avis 2 Écrire un Avis
  • Fernandes
    Ring
    Produto muito bem fabricado!
    Produto de relação qualidade/preço acima da média!
    Devem comprar este produto!
    Suggestion
    Nada

    Aug 17,2018

  • nice
    good
    clean ajlajljlkjavjsaldvalkjdvldjflkajlkajflkajflnadnalkcmlakjfla;dvla;ldjal;slaslsjljslklskdmclksaclkdsflwlsdnvlkndvlkndfladlkadlfjajhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhhh

    Dec 18,2018

Questions et réponses des Clients

  • Tout
  • Information Produit
  • État des stocks
  • Paiement
  • À propos de l'Expédition
  • Autres

Soyez le premier à poser une question. Voulez-vous des points GB? Il suffit d'écrire une critique!

Soyez le premier à poser une question. Voulez-vous des points GB? Il suffit d'écrire une critique!

Soyez le premier à poser une question. Voulez-vous des points GB? Il suffit d'écrire une critique!

Soyez le premier à poser une question. Voulez-vous des points GB? Il suffit d'écrire une critique!

Soyez le premier à poser une question. Voulez-vous des points GB? Il suffit d'écrire une critique!

Soyez le premier à poser une question. Voulez-vous des points GB? Il suffit d'écrire une critique!

0 Questions & Réponses Voir Tout>

Produits sponsorisés liés à cet article

Vos articles vus récemment

Voir des recommandations personnalisées

Nouveau client? Commencer ici
Service Après-Vente